PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 313aa    MW: 33691.2 Da    PI: 9.2791
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774363.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-3870129362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e+ lkcprCds+ntkfCy+nny+l+qPr+fCk+CrryWt+GGalr vPvGgg+r+nk+s+
  XP_009774363.1  70 EAGLKCPRCDSSNTKFCYFNNYNLAQPRHFCKSCRRYWTRGGALRSVPVGGGCRRNKRSK 129
                     6779*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3653122IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3272127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47873127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MSFSSFPVYL DHPNLQQLQQ LDHNQQGNPG LENSQLPTAV PPAHVGGSPG SIRPGSMVDR  60
ARLAKIPLPE AGLKCPRCDS SNTKFCYFNN YNLAQPRHFC KSCRRYWTRG GALRSVPVGG  120
GCRRNKRSKS TNNSSKTAGG NNTAERQIGT TSTSTSASPS SCSKEITGQH FSQSSTHLTP  180
LMAAFQNLNH QYGGFQPPPL VSTQNNGGLG HEMGFQIGNS TNNLQAATGG SDHHQWRLPS  240
LAATNLYPFQ GEGIEATPSG ISHQDSVVRM EENNQGLNST KQFLGTMENN QYWGGNAWTG  300
FSGLNSSSAG HLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5389771e-70AJ538977.1 Nicotiana tabacum cDNA-AFLP-fragment BT31-M2-065.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774236.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_009774300.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_009774363.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_009774425.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLQ9M4G11e-125Q9M4G1_SOLTU; Dof zinc finger protein
STRINGPGSC0003DMT4000781641e-122(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-42Dof family protein